PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G25000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 312aa    MW: 31900.2 Da    PI: 5.2207
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G25000.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.45.7e-072573245
                     SSS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwq 45
                     g WT e ++ + +a +  G +       W++ a+ +  g+t+ +++ ++ 
  OMERI04G25000.1 25 GGWTREQEKAFENALATVGDDeeegdgLWEKLAEAVE-GKTADEVRRHYE 73
                     56*****************99****************.**********95 PP

2Myb_DNA-binding39.71.1e-12139183347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  OMERI04G25000.1 139 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 183
                      6*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.5712280IPR017884SANT domain
SMARTSM007172.9E-52378IPR001005SANT/Myb domain
PfamPF002492.0E-52573IPR001005SANT/Myb domain
SuperFamilySSF466894.09E-92682IPR009057Homeodomain-like
CDDcd001679.20E-62776No hitNo description
PROSITE profilePS5129416.605132188IPR017930Myb domain
SuperFamilySSF466892.08E-16134189IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-17136186IPR006447Myb domain, plants
SMARTSM007179.3E-11136186IPR001005SANT/Myb domain
CDDcd001673.57E-10139184No hitNo description
PfamPF002493.6E-11139183IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-10139182IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MAVEEASSSS GGGGGGGEEG LSGCGGWTRE QEKAFENALA TVGDDEEEGD GLWEKLAEAV  60
EGKTADEVRR HYELLVEDVD GIEAGRVPLL VYAGDGGAEE GSAGGGKKGG GGGGGGGVGG  120
HGEKGSAKSA EQERRKGIAW TEDEHRLFLL GLEKYGKGDW RSISRNFVIS RTPTQVASHA  180
QKYFIRLNSM NRERRRSSIH DITSVNNGDT SAAQGPITGQ PNGPSANPGK SSKQSPQPAN  240
APPGVDAYGT TIGQPVGGPL VSAVGTPVTL PVPAAPHIAY GMHAPVPGAV VPGAPVNMPP  300
MPYPMPPPTS HG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1327971178RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104112GGKKGGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0686230.0AK068623.1 Oryza sativa Japonica Group cDNA clone:J013153N23, full insert sequence.
GenBankAK1061660.0AK106166.1 Oryza sativa Japonica Group cDNA clone:001-208-B07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636999.11e-172PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-55DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0E0DK530.0A0A0E0DK53_9ORYZ; Uncharacterized protein
STRINGORGLA04G0258700.11e-172(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63763854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.14e-80MYB family protein